PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00059157001
Common NameGSBRNA2T00059157001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 300aa    MW: 32644.4 Da    PI: 9.767
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00059157001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.94.6e-381978362
               zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                           +lkcprCds+ntkfCyynnyslsqPryfCkaC+ryWt+GG+lrnvPvGg+ rknk+++
  GSBRNA2T00059157001 19 PPQLKCPRCDSSNTKFCYYNNYSLSQPRYFCKACKRYWTQGGTLRNVPVGGSYRKNKRVK 78
                         5689*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.4E-332176IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.7232276IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-252276IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102460IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MQSKNTIVAP SHQQQQQQPP QLKCPRCDSS NTKFCYYNNY SLSQPRYFCK ACKRYWTQGG  60
TLRNVPVGGS YRKNKRVKRP ATTTVASTAS TTTSSSPKNP HHQISQFSSV NHHPLFYGLS  120
DHVSSCNNLP MMVPSRFSDS SKTSSSSGLE SEFISSGFSG LGALGLGLPY YLNHDHTING  180
SFLNNSTTNK PFLLSGLFGS SVSSSSSTLL QHPHKTINNG GEMMGQSHIR TLAPLPHVGG  240
NTDDMNKEGK LDQISGNING FMSSSSLNPS NYNNIWNNAS SMERLLISQI MTLDPSLPP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00059157001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013623457.10.0PREDICTED: dof zinc finger protein DOF1.4-like
SwissprotQ9FZA41e-126DOF14_ARATH; Dof zinc finger protein DOF1.4
TrEMBLA0A078HE630.0A0A078HE63_BRANA; BnaC03g58500D protein
TrEMBLA0A0D3BIM20.0A0A0D3BIM2_BRAOL; Uncharacterized protein
STRINGBra010884.1-P1e-147(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47092650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.14e-88Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]